Anti-SOCS5
Catalog Number:
ATA-HPA031964
| Article Name: |
Anti-SOCS5 |
| Biozol Catalog Number: |
ATA-HPA031964 |
| Supplier Catalog Number: |
HPA031964 |
| Alternative Catalog Number: |
ATA-HPA031964-100,ATA-HPA031964-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
CIS6, Cish5, CISH6, KIAA0671, SOCS-5 |
| Rabbit Polyclonal SOCS5 Antibody against Human suppressor of cytokine signaling 5. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.3 |
| NCBI: |
9655 |
| UniProt: |
O75159 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
HSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKP |
![]()
|
WB Image Caption 1 |
