Anti-CXCR2
Catalog Number:
ATA-HPA031999
- Images (9)
| Article Name: | Anti-CXCR2 |
| Biozol Catalog Number: | ATA-HPA031999 |
| Supplier Catalog Number: | HPA031999 |
| Alternative Catalog Number: | ATA-HPA031999-100,ATA-HPA031999-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD182, CMKAR2, IL8RB |
| chemokine (C-X-C motif) receptor 2 |
| Anti-CXCR2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3579 |
| UniProt: | P25025 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CXCR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-CXCR2 antibody. Corresponding CXCR2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and spleen using Anti-CXCR2 antibody HPA031999 (A) shows similar protein distribution across tissues to independent antibody HPA032017 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-CXCR2 antibody HPA031999. |
|
|
Immunohistochemical staining of human colon using Anti-CXCR2 antibody HPA031999. |
|
|
HPA031999-100ul |
|
|
HPA031999-100ul |
|
|
HPA031999-100ul |
Product Guarantee and Expert Support
