Anti-ADD2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA034509
Article Name: Anti-ADD2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA034509
Supplier Catalog Number: HPA034509
Alternative Catalog Number: ATA-HPA034509-100,ATA-HPA034509-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADDB
adducin 2 (beta)
Anti-ADD2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 119
UniProt: P35612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADD2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-ADD2 antibody. Corresponding ADD2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA034509
HPA034509
HPA034509