Anti-MRPL53

Catalog Number: ATA-HPA034612
Article Name: Anti-MRPL53
Biozol Catalog Number: ATA-HPA034612
Supplier Catalog Number: HPA034612
Alternative Catalog Number: ATA-HPA034612-100,ATA-HPA034612-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 116540
UniProt: Q96EL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE
Target: MRPL53
Antibody Type: Monoclonal Antibody
HPA034612-100ul