Anti-TSPYL6

Catalog Number: ATA-HPA034699
Article Name: Anti-TSPYL6
Biozol Catalog Number: ATA-HPA034699
Supplier Catalog Number: HPA034699
Alternative Catalog Number: ATA-HPA034699-100,ATA-HPA034699-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TSPYL6
TSPY-like 6
Anti-TSPYL6
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 388951
UniProt: Q8N831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KALETCGAGRSESEVIAEGKAEDVKPEECAMFSAPVDEKPGGEEMDVAEENRAIDEVNREAG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TSPYL6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-TSPYL6 antibody. Corresponding TSPYL6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA034699
HPA034699
HPA034699