Anti-DNAH7

Catalog Number: ATA-HPA034724
Article Name: Anti-DNAH7
Biozol Catalog Number: ATA-HPA034724
Supplier Catalog Number: HPA034724
Alternative Catalog Number: ATA-HPA034724-100,ATA-HPA034724-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0944
dynein, axonemal, heavy chain 7
Anti-DNAH7
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 56171
UniProt: Q8WXX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNAH7
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemical staining of human fallopian tube shows positivity in cilia.
HPA034724-100ul