Anti-TBC1D7
Catalog Number:
ATA-HPA034748
- Images (9)
| Article Name: | Anti-TBC1D7 |
| Biozol Catalog Number: | ATA-HPA034748 |
| Supplier Catalog Number: | HPA034748 |
| Alternative Catalog Number: | ATA-HPA034748-100,ATA-HPA034748-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | dJ257A7.3, FLJ32666 |
| TBC1 domain family, member 7 |
| Anti-TBC1D7 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 51256 |
| UniProt: | Q9P0N9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TBC1D7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong granular positivity in neuropil. |
|
|
Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human testis shows weak to moderate granular cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA034748-100ul |
|
|
|
|
|
HPA034748-100ul |
|
|
HPA034748-100ul |
Product Guarantee and Expert Support
