Anti-ASPRV1
Catalog Number:
ATA-HPA034810
- Images (9)
| Article Name: | Anti-ASPRV1 |
| Biozol Catalog Number: | ATA-HPA034810 |
| Supplier Catalog Number: | HPA034810 |
| Alternative Catalog Number: | ATA-HPA034810-100,ATA-HPA034810-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ25084, SASPase, Taps |
| aspartic peptidase, retroviral-like 1 |
| Anti-ASPRV1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 151516 |
| UniProt: | Q53RT3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ASPRV1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human skin and liver tissues using Anti-ASPRV1 antibody. Corresponding ASPRV1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and skin using Anti-ASPRV1 antibody HPA034810 (A) shows similar protein distribution across tissues to independent antibody HPA034809 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-ASPRV1 antibody HPA034810. |
|
|
Immunohistochemical staining of human colon using Anti-ASPRV1 antibody HPA034810. |
|
|
HPA034810-100ul |
|
|
HPA034810-100ul |
|
|
HPA034810-100ul |
Product Guarantee and Expert Support
