Anti-XIRP2
Catalog Number:
ATA-HPA034813
- Images (7)
| Article Name: | Anti-XIRP2 |
| Biozol Catalog Number: | ATA-HPA034813 |
| Supplier Catalog Number: | HPA034813 |
| Alternative Catalog Number: | ATA-HPA034813-100,ATA-HPA034813-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMYA3 |
| xin actin-binding repeat containing 2 |
| Anti-XIRP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 129446 |
| UniProt: | A4UGR9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HAPPTYEDVIAGHILDISDSPKEVRKNFQKTWQESGRVFKGLGYATADASATEMRTTFQEESAFISEAAAPRQGNMYTLSKDSLSNGVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | XIRP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lymph node shows no positivity in germinal center cells as expected. |
|
|
Immunohistochemical staining of human skin shows low cytoplasmic positivity in squamous epithelial cells as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human heart muscle shows moderate to strong membranous positivity in cardiomyocytes. |
|
|
HPA034813-100ul |
|
|
HPA034813-100ul |
|
|
HPA034813-100ul |
Product Guarantee and Expert Support
