Anti-UBTD1
Catalog Number:
ATA-HPA034825
- Images (9)
| Article Name: | Anti-UBTD1 |
| Biozol Catalog Number: | ATA-HPA034825 |
| Supplier Catalog Number: | HPA034825 |
| Alternative Catalog Number: | ATA-HPA034825-100,ATA-HPA034825-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ11807 |
| ubiquitin domain containing 1 |
| Anti-UBTD1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 80019 |
| UniProt: | Q9HAC8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UBTD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in Leydig cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in keratinocytes. |
|
|
HPA034825-100ul |
|
|
|
|
|
HPA034825-100ul |
|
|
HPA034825-100ul |
Product Guarantee and Expert Support
