Anti-TMPRSS15

Catalog Number: ATA-HPA034857
Article Name: Anti-TMPRSS15
Biozol Catalog Number: ATA-HPA034857
Supplier Catalog Number: HPA034857
Alternative Catalog Number: ATA-HPA034857-100,ATA-HPA034857-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ENTK, MGC133046, PRSS7
Clonality: Polyclonal
Isotype: IgG
NCBI: 5651
UniProt: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QKEGNYGDNWNYGQVTLNETVKFKVAFNAFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSSTNFPNSYPN
Target: TMPRSS15
Antibody Type: Monoclonal Antibody
HPA034857-100ul