Anti-ARHGAP26
Catalog Number:
ATA-HPA035106
- Images (8)
| Article Name: | Anti-ARHGAP26 |
| Biozol Catalog Number: | ATA-HPA035106 |
| Supplier Catalog Number: | HPA035106 |
| Alternative Catalog Number: | ATA-HPA035106-100,ATA-HPA035106-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GRAF, KIAA0621, OPHN1L, OPHN1L1 |
| Rho GTPase activating protein 26 |
| Anti-ARHGAP26 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 23092 |
| UniProt: | Q9UNA1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ARHGAP26 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA035106-100ul |
|
|
|
|
|
|
|
|
HPA035106-100ul |
|
|
HPA035106-100ul |
Product Guarantee and Expert Support
