Anti-FSTL1

Catalog Number: ATA-HPA035251
Article Name: Anti-FSTL1
Biozol Catalog Number: ATA-HPA035251
Supplier Catalog Number: HPA035251
Alternative Catalog Number: ATA-HPA035251-100,ATA-HPA035251-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FRP, FSL1
follistatin-like 1
Anti-FSTL1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 11167
UniProt: Q12841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FSTL1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
Western blot analysis in human cell lines U2OS and Caco-2 using Anti-FSTL1 antibody. Corresponding FSTL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in control (vector only transfected HEK293T lysate) and FSTL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402088).
HPA035251-100ul
HPA035251-100ul
HPA035251-100ul