Anti-MXI1
Catalog Number:
ATA-HPA035320
| Article Name: |
Anti-MXI1 |
| Biozol Catalog Number: |
ATA-HPA035320 |
| Supplier Catalog Number: |
HPA035320 |
| Alternative Catalog Number: |
ATA-HPA035320-100,ATA-HPA035320-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
bHLHc11, MAD2, MXD2, MXI |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
4601 |
| UniProt: |
P50539 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
RERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGP |
| Target: |
MXI1 |
| Antibody Type: |
Monoclonal Antibody |
![]()
|
HPA035320-100ul |
