Anti-ANKRD35

Catalog Number: ATA-HPA035453
Article Name: Anti-ANKRD35
Biozol Catalog Number: ATA-HPA035453
Supplier Catalog Number: HPA035453
Alternative Catalog Number: ATA-HPA035453-100,ATA-HPA035453-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ25124
ankyrin repeat domain 35
Anti-ANKRD35
Clonality: Polyclonal
Concentration: 0.8 mg/ml
Isotype: IgG
NCBI: 148741
UniProt: Q8N283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEARLERVLARLEWAKAGLQVKPEVPSQESREGALKAAPGSIKQDEEKEKRVPGA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ANKRD35
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-ANKRD35 antibody. Corresponding ANKRD35 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA035453-100ul
HPA035453-100ul
HPA035453-100ul