Anti-HNMT

Catalog Number: ATA-HPA035481
Article Name: Anti-HNMT
Biozol Catalog Number: ATA-HPA035481
Supplier Catalog Number: HPA035481
Alternative Catalog Number: ATA-HPA035481-100,ATA-HPA035481-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HNMT
histamine N-methyltransferase
Anti-HNMT
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 3176
UniProt: P50135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HNMT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA035481-100ul
HPA035481-100ul
HPA035481-100ul