Anti-HCK

Catalog Number: ATA-HPA035534
Article Name: Anti-HCK
Biozol Catalog Number: ATA-HPA035534
Supplier Catalog Number: HPA035534
Alternative Catalog Number: ATA-HPA035534-100,ATA-HPA035534-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: JTK9
Clonality: Polyclonal
Concentration: 0,2
NCBI: 3055
UniProt: P08631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVA
Target: HCK
HPA035534-100ul