Anti-AARS2

Catalog Number: ATA-HPA035636
Article Name: Anti-AARS2
Biozol Catalog Number: ATA-HPA035636
Supplier Catalog Number: HPA035636
Alternative Catalog Number: ATA-HPA035636-100,ATA-HPA035636-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AARSL, bA444E17.1, KIAA1270
alanyl-tRNA synthetase 2, mitochondrial
Anti-AARS2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 57505
UniProt: Q5JTZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: AARS2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA035636-100ul
HPA035636-100ul
HPA035636-100ul