Anti-ADD3

Catalog Number: ATA-HPA035696
Article Name: Anti-ADD3
Biozol Catalog Number: ATA-HPA035696
Supplier Catalog Number: HPA035696
Alternative Catalog Number: ATA-HPA035696-100,ATA-HPA035696-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADDL
adducin 3 (gamma)
Anti-ADD3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 120
UniProt: Q9UEY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADD3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane.
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA035696-100ul
HPA035696-100ul
HPA035696-100ul