Anti-MYOZ2
Catalog Number:
ATA-HPA035763
- Images (9)
| Article Name: | Anti-MYOZ2 |
| Biozol Catalog Number: | ATA-HPA035763 |
| Supplier Catalog Number: | HPA035763 |
| Alternative Catalog Number: | ATA-HPA035763-100,ATA-HPA035763-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C4orf5, CS-1 |
| myozenin 2 |
| Anti-MYOZ2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 51778 |
| UniProt: | Q9NPC6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESED |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MYOZ2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-MYOZ2 antibody. Corresponding MYOZ2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle, kidney, liver and prostate using Anti-MYOZ2 antibody HPA035763 (A) shows similar protein distribution across tissues to independent antibody HPA035764 (B). |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-MYOZ2 antibody HPA035763. |
|
|
Immunohistochemical staining of human kidney using Anti-MYOZ2 antibody HPA035763. |
|
|
HPA035763-100ul |
|
|
HPA035763-100ul |
|
|
HPA035763-100ul |
Product Guarantee and Expert Support
