Anti-MMRN1

Catalog Number: ATA-HPA035769
Article Name: Anti-MMRN1
Biozol Catalog Number: ATA-HPA035769
Supplier Catalog Number: HPA035769
Alternative Catalog Number: ATA-HPA035769-100,ATA-HPA035769-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ECM, EMILIN4, GPIa*, MMRN
multimerin 1
Anti-MMRN1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 22915
UniProt: Q13201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MMRN1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum.
Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-MMRN1 antibody. Corresponding MMRN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human gallbladder shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA035769-100ul
HPA035769-100ul
HPA035769-100ul