Anti-TMPRSS2
Catalog Number:
ATA-HPA035787
- Images (8)
| Article Name: | Anti-TMPRSS2 |
| Biozol Catalog Number: | ATA-HPA035787 |
| Supplier Catalog Number: | HPA035787 |
| Alternative Catalog Number: | ATA-HPA035787-100,ATA-HPA035787-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PRSS10 |
| transmembrane protease, serine 2 |
Anti-TMPRSS2 TMPRSS2 The serine protease TMPRSS is a co-receptor for SARS-Cov-2 together with ACE2 (Lucassen et al. 2020 in press) and primes the viral spike protein of SARS-Cov-2 (Hoffmann et al. 2020). TMRSS binds the same transient bronchial secretory cell type as ACE2 (Lucassen et al. 2020 in press). References: Hoffmann M et al. (2020), SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, Issue 2, 1271-280.e8 Lukassen S. et al. (2020), SARS‐CoV‐2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells. EMBO J (2020)e105114https://doi.org/10.15252/embj.20105114 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7113 |
| UniProt: | O15393 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMPRSS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |









