Anti-CDK5RAP2

Catalog Number: ATA-HPA035821
Article Name: Anti-CDK5RAP2
Biozol Catalog Number: ATA-HPA035821
Supplier Catalog Number: HPA035821
Alternative Catalog Number: ATA-HPA035821-100,ATA-HPA035821-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C48, CEP215, FLJ10867, MCPH3
Clonality: Polyclonal
Isotype: IgG
NCBI: 55755
UniProt: Q96SN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCD
Target: CDK5RAP2
Antibody Type: Monoclonal Antibody
HPA035821-100ul