Anti-PCDHGB3

Catalog Number: ATA-HPA035822
Article Name: Anti-PCDHGB3
Biozol Catalog Number: ATA-HPA035822
Supplier Catalog Number: HPA035822
Alternative Catalog Number: ATA-HPA035822-100,ATA-HPA035822-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PCDH-GAMMA-B3
Clonality: Polyclonal
Isotype: IgG
NCBI: 56102
UniProt: Q9Y5G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLRLRCSSRPATEGYFQPGVCFKTVPGVLPTYSERTLPYSYNPCAASHSSNTEFKFLNIKAENAAPQDLLCDEASWFESNDNPEMPSNSGNLQ
Target: PCDHGB3
Antibody Type: Monoclonal Antibody
HPA035822-100ul