Anti-FAM193B

Catalog Number: ATA-HPA035847
Article Name: Anti-FAM193B
Biozol Catalog Number: ATA-HPA035847
Supplier Catalog Number: HPA035847
Alternative Catalog Number: ATA-HPA035847-100,ATA-HPA035847-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10404, IRIZIO, KIAA1931
Clonality: Polyclonal
Isotype: IgG
NCBI: 54540
UniProt: Q96PV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NTVPNLSRVIWVKTPKPGYPSSEEPSSKEVPSCKQELPEPVSSGGKPQKGKRQGSQAKKSEASPAPRPPASLEVPSAKGQVAGPKQ
Target: FAM193B
Antibody Type: Monoclonal Antibody
HPA035847-100ul