Anti-LYAR

Catalog Number: ATA-HPA035881
Article Name: Anti-LYAR
Biozol Catalog Number: ATA-HPA035881
Supplier Catalog Number: HPA035881
Alternative Catalog Number: ATA-HPA035881-100,ATA-HPA035881-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZC2HC2, ZLYAR
Ly1 antibody reactive
Anti-LYAR
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55646
UniProt: Q9NX58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEER
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LYAR
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:5000 - 1:10000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry analysis in human testis and fallopian tube tissues using Anti-LYAR antibody. Corresponding LYAR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human fallopian tube shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA035881-100ul
HPA035881-100ul
HPA035881-100ul