Anti-COMMD8 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA035887
Article Name: Anti-COMMD8 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA035887
Supplier Catalog Number: HPA035887
Alternative Catalog Number: ATA-HPA035887-100,ATA-HPA035887-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20502
COMM domain containing 8
Anti-COMMD8
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 54951
UniProt: Q9NX08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COMMD8
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and COMMD8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413465).
HPA035887
HPA035887
HPA035887