Anti-PAICS
Catalog Number:
ATA-HPA035895
- Images (7)
| Article Name: | Anti-PAICS |
| Biozol Catalog Number: | ATA-HPA035895 |
| Supplier Catalog Number: | HPA035895 |
| Alternative Catalog Number: | ATA-HPA035895-100,ATA-HPA035895-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ADE2H1, AIRC, PAIS |
| phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase |
| Anti-PAICS |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 10606 |
| UniProt: | P22234 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PAICS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-PAICS antibody HPA035895 (A) shows similar pattern to independent antibody HPA041538 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA035895-100ul |
|
|
|
|
|
HPA035895-100ul |
|
|
HPA035895-100ul |
Product Guarantee and Expert Support
