Anti-CSN3 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CSN3 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA035954
• Supplier Catalog Number: HPA035954
• Alternative Catalog Number: ATA-HPA035954-100,ATA-HPA035954-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CSN10

Product Description

casein kappa

Additional Information

Anti-CSN3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1448
• UniProt: P07498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYAN
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CSN3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of human breast, colon, liver and testis using Anti-CSN3 antibody HPA035954 (A) shows similar protein distribution across tissues to independent antibody HPA035953 (B).

Immunohistochemical staining of human colon using Anti-CSN3 antibody HPA035954.

Immunohistochemical staining of human testis using Anti-CSN3 antibody HPA035954.

Immunohistochemical staining of human breast using Anti-CSN3 antibody HPA035954.

Immunohistochemical staining of human liver using Anti-CSN3 antibody HPA035954.

HPA035954

HPA035954

HPA035954