Anti-CSN3

Catalog Number: ATA-HPA035954
Article Name: Anti-CSN3
Biozol Catalog Number: ATA-HPA035954
Supplier Catalog Number: HPA035954
Alternative Catalog Number: ATA-HPA035954-100,ATA-HPA035954-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CSN10
casein kappa
Anti-CSN3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1448
UniProt: P07498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYAN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CSN3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemical staining of human breast, colon, liver and testis using Anti-CSN3 antibody HPA035954 (A) shows similar protein distribution across tissues to independent antibody HPA035953 (B).
Immunohistochemical staining of human colon using Anti-CSN3 antibody HPA035954.
Immunohistochemical staining of human testis using Anti-CSN3 antibody HPA035954.
Immunohistochemical staining of human breast using Anti-CSN3 antibody HPA035954.
Immunohistochemical staining of human liver using Anti-CSN3 antibody HPA035954.
HPA035954-100ul
HPA035954-100ul
HPA035954-100ul