Anti-SLC26A3

Catalog Number: ATA-HPA036055
Article Name: Anti-SLC26A3
Biozol Catalog Number: ATA-HPA036055
Supplier Catalog Number: HPA036055
Alternative Catalog Number: ATA-HPA036055-100,ATA-HPA036055-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLD, DRA
solute carrier family 26 (anion exchanger), member 3
Anti-SLC26A3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1811
UniProt: P40879
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC26A3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human colon shows moderate positivity in glandular cells of apical membrane.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human small intestine shows moderate to strong positivity in apical membrane in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC26A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400033).
HPA036055-100ul
HPA036055-100ul
HPA036055-100ul