Anti-TNS1
Catalog Number:
ATA-HPA036090
- Images (7)
| Article Name: | Anti-TNS1 |
| Biozol Catalog Number: | ATA-HPA036090 |
| Supplier Catalog Number: | HPA036090 |
| Alternative Catalog Number: | ATA-HPA036090-100,ATA-HPA036090-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp586K0617, MXRA6, PPP1R155, TNS |
| tensin 1 |
| Anti-TNS1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 7145 |
| UniProt: | Q9HBL0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TNS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human lung shows moderate positivity. |
|
|
Immunohistochemical staining of human testis shows moderate membranous positivity. |
|
|
Immunohistochemical staining of human smooth muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes. |
|
|
HPA036090-100ul |
|
|
HPA036090-100ul |
|
|
HPA036090-100ul |
Product Guarantee and Expert Support
