Anti-CRHBP

Catalog Number: ATA-HPA036234
Article Name: Anti-CRHBP
Biozol Catalog Number: ATA-HPA036234
Supplier Catalog Number: HPA036234
Alternative Catalog Number: ATA-HPA036234-100,ATA-HPA036234-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRF-BP, CRFBP
Clonality: Polyclonal
Isotype: IgG
NCBI: 1393
UniProt: P24387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
Target: CRHBP
Antibody Type: Monoclonal Antibody
HPA036234-100ul