Anti-FAM98A

Catalog Number: ATA-HPA036250
Article Name: Anti-FAM98A
Biozol Catalog Number: ATA-HPA036250
Supplier Catalog Number: HPA036250
Alternative Catalog Number: ATA-HPA036250-100,ATA-HPA036250-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZP564F0522
family with sequence similarity 98, member A
Anti-FAM98A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 25940
UniProt: Q8NCA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAM98A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemical staining of human nasopharynx shows strong positivity in respiratory epithelial cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
HPA036250-100ul
HPA036250-100ul
HPA036250-100ul