Anti-CDH16

Catalog Number: ATA-HPA036260
Article Name: Anti-CDH16
Biozol Catalog Number: ATA-HPA036260
Supplier Catalog Number: HPA036260
Alternative Catalog Number: ATA-HPA036260-100,ATA-HPA036260-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CDH16
cadherin 16, KSP-cadherin
Anti-CDH16
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1014
UniProt: O75309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NSHVVYQLLSPEPEDGVEGRAFQVDPTSGSVTLGVLPLRAGQNILLLVLAMDLAGAEGGFSSTCEVEVAVTDINDHAPEFITSQIGPISLPEDVEPGTLVAMLTAIDADLEPAFRLMDFAIERGDTEGTFGLDWEPDS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CDH16
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-CDH16 antibody. Corresponding CDH16 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Kidney tissue
HPA036260-100ul
HPA036260-100ul
HPA036260-100ul