Anti-TRAIP

Catalog Number: ATA-HPA036262
Article Name: Anti-TRAIP
Biozol Catalog Number: ATA-HPA036262
Supplier Catalog Number: HPA036262
Alternative Catalog Number: ATA-HPA036262-100,ATA-HPA036262-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RNF206, TRIP
TRAF interacting protein
Anti-TRAIP
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10293
UniProt: Q9BWF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRAIP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-TRAIP antibody HPA036262 (A) shows similar protein distribution across tissues to independent antibody HPA036261 (B).
Immunohistochemical staining of human testis using Anti-TRAIP antibody HPA036262.
Immunohistochemical staining of human cerebral cortex using Anti-TRAIP antibody HPA036262.
Immunohistochemical staining of human liver using Anti-TRAIP antibody HPA036262.
Immunohistochemical staining of human kidney using Anti-TRAIP antibody HPA036262.
HPA036262-100ul
HPA036262-100ul
HPA036262-100ul