Anti-ODAM

Catalog Number: ATA-HPA036279
Article Name: Anti-ODAM
Biozol Catalog Number: ATA-HPA036279
Supplier Catalog Number: HPA036279
Alternative Catalog Number: ATA-HPA036279-100,ATA-HPA036279-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: APin, FLJ20513
Clonality: Polyclonal
Isotype: IgG
NCBI: 54959
UniProt: A1E959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGA
Target: ODAM
Antibody Type: Monoclonal Antibody
HPA036279-100ul