Anti-DNAJC12
Catalog Number:
ATA-HPA036289
- Images (6)
| Article Name: | Anti-DNAJC12 |
| Biozol Catalog Number: | ATA-HPA036289 |
| Supplier Catalog Number: | HPA036289 |
| Alternative Catalog Number: | ATA-HPA036289-100,ATA-HPA036289-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | JDP1 |
| DnaJ (Hsp40) homolog, subfamily C, member 12 |
| Anti-DNAJC12 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 56521 |
| UniProt: | Q9UKB3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJC12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |






