Anti-GUSB

Catalog Number: ATA-HPA036322
Article Name: Anti-GUSB
Biozol Catalog Number: ATA-HPA036322
Supplier Catalog Number: HPA036322
Alternative Catalog Number: ATA-HPA036322-100,ATA-HPA036322-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GUSB
glucuronidase, beta
Anti-GUSB
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2990
UniProt: P08236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GUSB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemical staining of human liver shows cytoplasmic positivity in bile duct cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and GUSB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400064).
HPA036322-100ul
HPA036322-100ul
HPA036322-100ul