Anti-ADGB
Catalog Number:
ATA-HPA036340
- Images (9)
| Article Name: | Anti-ADGB |
| Biozol Catalog Number: | ATA-HPA036340 |
| Supplier Catalog Number: | HPA036340 |
| Alternative Catalog Number: | ATA-HPA036340-100,ATA-HPA036340-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C6orf103, dJ408K24.1, FLJ23121 |
| androglobin |
| Anti-ADGB |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79747 |
| UniProt: | Q8N7X0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ADGB |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using HPA036340 antibody. Corresponding ADGB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human bronchus shows strong positivity in cilia in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
HPA036340-100ul |
|
|
HPA036340-100ul |
|
|
HPA036340-100ul |
Product Guarantee and Expert Support
