Anti-DMXL1
Catalog Number:
ATA-HPA036431
- Images (9)
| Article Name: | Anti-DMXL1 |
| Biozol Catalog Number: | ATA-HPA036431 |
| Supplier Catalog Number: | HPA036431 |
| Alternative Catalog Number: | ATA-HPA036431-100,ATA-HPA036431-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DMXL1 |
| Dmx-like 1 |
| Anti-DMXL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1657 |
| UniProt: | Q9Y485 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LDVSGILATQVYTWVDDDIEVETKGSEDFLVIHARDDLTAVQGTTPYTHSNPGTPINMPWLGSTQTGRGASVMIKKAINNVRRMTSHPTLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DMXL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in cytotrophoblast. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
HPA036431-100ul |
|
|
|
|
|
HPA036431-100ul |
|
|
HPA036431-100ul |
Product Guarantee and Expert Support
