Anti-LARP4B
Catalog Number:
ATA-HPA036566
- Images (8)
| Article Name: | Anti-LARP4B |
| Biozol Catalog Number: | ATA-HPA036566 |
| Supplier Catalog Number: | HPA036566 |
| Alternative Catalog Number: | ATA-HPA036566-100,ATA-HPA036566-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0217, LARP5 |
| La ribonucleoprotein domain family, member 4B |
| Anti-LARP4B |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 23185 |
| UniProt: | Q92615 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FENRLSSLIIGPSKERTLSADASVNTLPVVVSREPSVPASCAVSATYERSPSPAHLPDDPKVAEKQRETHSVDRLPSALTATACKSVQVN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LARP4B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Western blot analysis using Anti-LARP4B antibody HPA036566 (A) shows similar pattern to independent antibody HPA042738 (B). |
|
|
HPA036566-100ul |
|
|
|
|
|
|
|
|
HPA036566-100ul |
|
|
HPA036566-100ul |
Product Guarantee and Expert Support
