Anti-LRP2BP

Catalog Number: ATA-HPA036664
Article Name: Anti-LRP2BP
Biozol Catalog Number: ATA-HPA036664
Supplier Catalog Number: HPA036664
Alternative Catalog Number: ATA-HPA036664-100,ATA-HPA036664-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp761O0113
LRP2 binding protein
Anti-LRP2BP
Clonality: Polyclonal
Isotype: IgG
NCBI: 55805
UniProt: Q9P2M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LRP2BP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA036664 antibody. Corresponding LRP2BP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebellum, fallopian tube, liver and testis using Anti-LRP2BP antibody HPA036664 (A) shows similar protein distribution across tissues to independent antibody HPA036665 (B).
Immunohistochemical staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells as well as positivity in neural fibers.
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in Leydig cells.
HPA036664-100ul
HPA036664-100ul
HPA036664-100ul