Anti-SH3BP2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA036790
Article Name: Anti-SH3BP2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA036790
Supplier Catalog Number: HPA036790
Alternative Catalog Number: ATA-HPA036790-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRBM, RES4-23
SH3-domain binding protein 2
Anti-SH3BP2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 6452
UniProt: P78314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SH3BP2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA036790
HPA036790
HPA036790
HPA036790
HPA036790