Anti-MED26

Catalog Number: ATA-HPA036798
Article Name: Anti-MED26
Biozol Catalog Number: ATA-HPA036798
Supplier Catalog Number: HPA036798
Alternative Catalog Number: ATA-HPA036798-100,ATA-HPA036798-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRSP7, CRSP70
Clonality: Polyclonal
Concentration: 0,1
NCBI: 9441
UniProt: O95402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT
Target: MED26
HPA036798-100ul