Anti-RAI14 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA036949
Article Name: Anti-RAI14 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA036949
Supplier Catalog Number: HPA036949
Alternative Catalog Number: ATA-HPA036949-100,ATA-HPA036949-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp564G013, KIAA1334, NORPEG, RAI13
retinoic acid induced 14
Anti-RAI14
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 26064
UniProt: Q9P0K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RAI14
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Western blot analysis in human cell lines U2OS and MCF-7 using Anti-RAI14 antibody. Corresponding RAI14 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis using Anti-RAI14 antibody HPA036949 (A) shows similar pattern to independent antibody HPA036950 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA036949
HPA036949
HPA036949