Anti-GEMIN5

Catalog Number: ATA-HPA037393
Article Name: Anti-GEMIN5
Biozol Catalog Number: ATA-HPA037393
Supplier Catalog Number: HPA037393
Alternative Catalog Number: ATA-HPA037393-100,ATA-HPA037393-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GEMIN5
gem (nuclear organelle) associated protein 5
Anti-GEMIN5
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 25929
UniProt: Q8TEQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YDSGSFTIMQEVYSAFLPDGCDHLRDKLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPET
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GEMIN5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies & cytosol.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in purkinje cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA037393-100ul
HPA037393-100ul
HPA037393-100ul