Anti-RBM17
Catalog Number:
ATA-HPA037478
- Images (8)
| Article Name: | Anti-RBM17 |
| Biozol Catalog Number: | ATA-HPA037478 |
| Supplier Catalog Number: | HPA037478 |
| Alternative Catalog Number: | ATA-HPA037478-100,ATA-HPA037478-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC14439, SPF45 |
| RNA binding motif protein 17 |
| Anti-RBM17 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 84991 |
| UniProt: | Q96I25 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RBM17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human caudate shows strong nuclear positivity in neuronal and glial cells. |
|
|
Western blot analysis using Anti-RBM17 antibody HPA037478 (A) shows similar pattern to independent antibody HPA037477 (B). |
|
|
|
|
|
HPA037478-100ul |
|
|
|
|
|
HPA037478-100ul |
|
|
HPA037478-100ul |
Product Guarantee and Expert Support
