Anti-CCSER2
Catalog Number:
ATA-HPA037482
- Images (8)
| Article Name: | Anti-CCSER2 |
| Biozol Catalog Number: | ATA-HPA037482 |
| Supplier Catalog Number: | HPA037482 |
| Alternative Catalog Number: | ATA-HPA037482-100,ATA-HPA037482-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM190B, KIAA1128 |
| coiled-coil serine-rich protein 2 |
| Anti-CCSER2 |
| Clonality: | Polyclonal |
| Concentration: | 0.8 mg/ml |
| Isotype: | IgG |
| NCBI: | 54462 |
| UniProt: | Q9H7U1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCSER2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA037482-100ul |
|
|
|
|
|
|
|
|
HPA037482-100ul |
|
|
HPA037482-100ul |
Product Guarantee and Expert Support
