Anti-HADHB
Catalog Number:
ATA-HPA037540
- Images (8)
| Article Name: | Anti-HADHB |
| Biozol Catalog Number: | ATA-HPA037540 |
| Supplier Catalog Number: | HPA037540 |
| Alternative Catalog Number: | ATA-HPA037540-100,ATA-HPA037540-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MTPB |
| hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit |
| Anti-HADHB |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3032 |
| UniProt: | P55084 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HADHB |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-HADHB antibody. Corresponding HADHB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Western blot analysis using Anti-HADHB antibody HPA037540 (A) shows similar pattern to independent antibody HPA037539 (B). |
|
|
|
|
|
HPA037540 |
|
|
HPA037540 |
|
|
HPA037540 |
Product Guarantee and Expert Support
