Anti-CCDC34

Catalog Number: ATA-HPA037574
Article Name: Anti-CCDC34
Biozol Catalog Number: ATA-HPA037574
Supplier Catalog Number: HPA037574
Alternative Catalog Number: ATA-HPA037574-100,ATA-HPA037574-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: L15, NY-REN-41, RAMA3
coiled-coil domain containing 34
Anti-CCDC34
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Isotype: IgG
NCBI: 91057
UniProt: Q96HJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCDC34
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center & nuclear membrane.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear membrane positivity in neuronal cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA037574-100ul
HPA037574-100ul
HPA037574-100ul